<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG21 TVGG21 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT 44
2 AZT+DDI 4
3 3TC+AZT 91
4 3TC+D4T+RTV 65

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A Q58E L10I, I15V, K20R, E35D, M36I, R41K, R57K, Q61N, L63P, E65D  
>TVGG21| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFVKVKEYD
NIPIDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F       E6N, V35T, S68G, V118I, K122E, K173I, Q174K, Q207E, R211K, F214L, V245Q, A272P, T286A, E291D, V292I, I293V, P294T, E297A T253S
>TVGG21| codons 1-324
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLKWGLFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKDSWSVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVTLTAEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002