<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVSP24 TVSP24 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 19
2 3TC+AZT 47
3 3TC+D4T 28
4 D4T+DDI+RTV 1
5 3TC+D4T+NFV 1
6 Unknown 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q18L, N37E, R57K, L63P, V77I, I93L G17S
>TVSP24| codons 1-99
PQITLWQRPLVTIKIGSLLKEALLDTGADDTVLEEMELPGRWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F       K49R, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K, V245Q, E248D, K277R, T286A, V292I, I293V, E297A, S322A  
>TVSP24| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELREHLLKWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEIVPLTAEAE
LELAENREILKEPVHGVYYDPAKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005