<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
TVGG13 TVGG13 Brazil 1999 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 60

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, R41K, R57K, D60E, Q61N, I62V, L63S, L89M  
>TVGG13| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYE
NVSIEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, T215Y       V35M, I135V, S162C, E169A, K173A, Q174K, Q207E, R211Q, V245Q, E248D, A272P, E291D, V292I, I293V  
>TVGG13| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILAPFRAKNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLLQWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Brindeiro, PA Testing genotypic and phenotypic resistance in human immunodeficiency virus type 1 isolates of clade B and other clades from children failing antiretroviral therapy. J Clin Microbiol, 2002