<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR8 BR8 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 17
2 D4T+ 3TC 86
3 D4T+ DDI+ NFV 43

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N   L10I, T12I, I13V, I15V, K20T, E35D, M36I, R41K, K45T, L63P, I64IV, I85IV  
>BR8| codons 1-99
PQITLWQRPIVIVKVGGQLTEALLDTGADNTVLEDINLPGKWKPTMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIVGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219R     K20R, K32R, T39S, V60I, V90I, V118I, I142V, E169D, H208Y, R211K, K223Q  
>BR8| codons 1-233
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIRALVEICSELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKVVDFRELNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDRKHQQEPPFLWMGYE

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005