<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR7 BR7 Brazil 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ AZT+ 3TC 130

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, L210LW, T215Y K219KQ     K122E, I135T, E169D, I202V, Q207E, R211K, A272P, K277R, V292I, I293V, E297A, K311R, V317A, I329V, G333E, Q334L K30R
>BR7| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEERIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKVEELREHLWKWGFYTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEIVPLTAEAE
LELAENREILREPVHGAYYDPSKDLIAEVQKQELG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, N88S K43T L10I, K20R, E35D, M36I, R41K, R57K, D60DE, Q61N, I62IV, L63A, I93L  
>BR7| codons 1-99
PQITLWQRPIVTIKIGGQLREALLDTGADDTVLEDINLPGKWTPKMIGGIGGFVKVKQYE
NVAIEICGHKAIGTVLVGPTPVNIIGRSLLTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005