Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| BR6 | BR6 | Brazil | 2002 | HIV1 | C | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | SQV+ AZT+ DDC | 56 |
| 2 | 3TC+ RTV+ AZT | 21 |
| 3 | 3TC+ RTV+ D4T | 99 |
| 4 | D4T+ RTV+ DDI+ SQV | 48 |
| 5 | 3TC+ RTV+ IDV+ AZT | 82 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, I84V, L90M | L89V | L10V, I13V, I15V, G16A, K20M, E35D, M36I, N37K, R41N, D60E, L63P, H69K, A71V, I93L |
| >BR6| codons 1-99 PQITLWQRPVVTVKVAGQLMEALLDTGADDTVLEDIKLPGNWKPKMIGGIGGFVKVRQYE QIPIEICGKKVIGTVLVGPTPVNVIGRNVMTQLGCTLNF |
References
| Author | Title | Citation |
| Non-B Workgroup | Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. | PLoS Med, 2005 |