<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR6 BR6 Brazil 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 SQV+ AZT+ DDC 56
2 3TC+ RTV+ AZT 21
3 3TC+ RTV+ D4T 99
4 D4T+ RTV+ DDI+ SQV 48
5 3TC+ RTV+ IDV+ AZT 82

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, I84V, L90M L89V L10V, I13V, I15V, G16A, K20M, E35D, M36I, N37K, R41N, D60E, L63P, H69K, A71V, I93L  
>BR6| codons 1-99
PQITLWQRPVVTVKVAGQLMEALLDTGADDTVLEDIKLPGNWKPKMIGGIGGFVKVRQYE
QIPIEICGKKVIGTVLVGPTPVNVIGRNVMTQLGCTLNF

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005