<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR37 BR37 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 13
2 DDI+ NFV+ AZT 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, T215F       K49R, I135V, S162C, E169D, K173A, Q174K, T200A, Q207E, R211K  
>BR37| codons 36-225
EICTEMEKEGKISRIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIP
HPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKG
SPAIFQCSMTKILDPFRAKNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFF
TPDKKHQKEP

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005