<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR1 BR1 Brazil 2002 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 65
2 SQV 35
3 3TC+AZT+IDV 91
4 AZT+DDI+EFV 153
5 3TC+AZT+LPV 13

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, I15V, E35D, M36I, P39T, R41K, R57K, Q61N, L89M  
>BR1| codons 4-99
TLWQRPLVTIRVGGQLKEALLDTGADDTVLEDINLTGKWKPKMIGGIGGFIKVKQYDNIL
IEICGHKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, G45E, I135V, S162C, E169D, K173A, Q174K, T200A, I202V, R206K, Q207E, R211K S191T
>BR1| codons 1-225
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEEKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRAKNPDIVI
YQYMDDLYVGTDLEIGQHRAKVEELKEHLLKWGFTTPDKKHQKEP

References
Author Title Citation
Soares, EA Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. JAIDS, 2003
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006