<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR36 BR36 Brazil 2001 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 147

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q2P, L10V, E35D, M36I, R41K, Q61N, L63S, V77I, L89M  
>BR36| codons 1-98
PPITLWQRPVVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
NISIEICGHKAIGTVLIGPTPVNIIGRNMLTQIGCTLN

References
Author Title Citation
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005