<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BR52 BR52 Brazil 2002 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 NFV+ DDC+ AZT 56
2 SQV+ RTV+ 3TC+ AZT 143

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, N37K, R41N, D60E, H69K, L89M, I93L  
>BR52| codons 1-99
PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEMKLPGNWKPKMIGGIGGFIKVRQYE
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39E, S48T, K122E, D123S, I135V, K173A, D177E, T200A, Q207E, R211K  
>BR52| codons 1-225
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEP

References
Author Title Citation
Soares, EA Epidemiologic and molecular characterization of human immunodeficiency virus type 1 in southern Brazil. JAIDS, 2003
Santos, AF Characterization of a new circulating recombinant form comprising HIV-1 subtypes C and B in southern Brazil. AIDS, 2006