<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN25 JPN25 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDI+ AZT 36
2 AZT+ 3TC 49
3 AZT+ 3TC+ NFV 25
4 DDI+ D4T+ NFV 48

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S L10F, L33I, Q58QE, L89V I13V, K20T, E35D, M36I, R41K, I62IV, H69K  
>JPN25| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADDTVIEDINLPGKWKPKIIGGIGGFIKVREYD
QVLIEICGKKAIGTVLVGPTPVNIIGRSVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y     A98G E6D, K11T, V35T, T39K, K43E, E44D, V118I, D123N, I135T, K173I, Q174K, D177E, T200K, K201I, E204EV, Q207A, H208Y, R211N, K238R, V245E  
>JPN25| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSIPL
DKNFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRKIIEVLRAYLWNWGFYTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWT

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005