<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN41 JPN41A Japan 1998 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 DDC+ AZT 2
3 IDV+ AZT 53
4 SQV+ 3TC+ AZT 25
5 NFV+ 3TC+ D4T+ DDI+ AZT 47

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48ST, I54V, V82F, L90M   L10I, I13V, G16E, K20I, E35D, M36I, P39Q, R41K, K45V, I62V, L63P, H69K, L89M  
>JPN41A| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDINLQGKWKPVMISGIGGFVKVRQYD
QVPIEICGKKAIGTVLVGPTPFNIIGRNMMTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003