Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| JPN41 | JPN41A | Japan | 1998 | HIV1 | CRF01_AE | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT | 82 |
| 2 | DDC+ AZT | 2 |
| 3 | IDV+ AZT | 53 |
| 4 | SQV+ 3TC+ AZT | 25 |
| 5 | NFV+ 3TC+ D4T+ DDI+ AZT | 47 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48ST, I54V, V82F, L90M | L10I, I13V, G16E, K20I, E35D, M36I, P39Q, R41K, K45V, I62V, L63P, H69K, L89M |
| >JPN41A| codons 1-99 PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDINLQGKWKPVMISGIGGFVKVRQYD QVPIEICGKKAIGTVLVGPTPFNIIGRNMMTQIGCTLNF |
References
| Author | Title | Citation |
| Ariyoshi, K | Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. | JAIDS, 2003 |