<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN41 JPN41B Japan 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 82
2 DDC+ AZT 2
3 IDV+ AZT 53
4 SQV+ 3TC+ AZT 25
5 NFV+ 3TC+ D4T+ DDI+ AZT 52
6 NFV+ D4T+ DDC 3
7 NVP+ D4T+ DDI 27
8 None 8
9 AZT+ NVP 5
10 APV+ NVP+ AZT 62

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, L210W, T215F K219W Y181C V108I E6D, K11KT, V35T, T39K, K43E, K122E, D123NS, I135L, S162C, R172K, K173I, Q174K, D177E, I178M, T200A, Q207A, R211RKNS, L228H  
>JPN41B| codons 1-242
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKNSDRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTILDVGDAYFSVPL
DESFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFKIKNPEMVI
CQYMDDLYVGSDLEIGQHRAKIEELRAHLWSWGFFTPDWKHQKEPPFHWMGYELHPDKWT
VQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90LM   L10I, I13V, G16E, K20I, E35DN, M36I, P39Q, R41K, K45V, G48X, I62V, L63P, H69K, L89M  
>JPN41B| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDINLQGKWKPVMIXGIGGFVKVRQYD
QVPIEICGKKAIGTVLVGPTPFNIIGRNMMTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005