<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN24 JPN24 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT 48
2 None 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F T12S, I13V, M36I, N37D, R41K, H69K, K70R, L89M, I93L K45KE
>JPN24| codons 1-99
PQITLWQRPLVSVKIGGQLKEALLDTGADDTVFEEIDLPGKWKPEMIGGIGGFIKVRQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K11T, I31T, V35T, T39KQ, K43E, S68G, K122E, D123S, K173I, Q174K, D177E, I178M, T200TA, I202L, Q207A, R211S  
>JPN24| codons 1-243
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKTKALTEICQEMEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKLEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005