<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN40 JPN40A Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 45
2 AZT+ DDC 14
3 AZT+ DDC+ IDV 35
4 3TC+ SQV+ AZT 29
5 D4T+ 3TC+ NFV 114
6 ABC+ EFV+ NFV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10F T12A, I13V, I15V, E35D, M36I, R41K, R57K, I64V, H69K, L89M  
>JPN40A| codons 1-99
PQITLWQRPFVAVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6D, K11T, V35T, T39K, K43E, K122E, D123S, K173I, Q174K, D177E, I178M, T200AE, Q207A, R211X, K238KR, I244IV, V245E  
>JPN40A| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLXWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPVELPEKDSWT

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003