<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN40 JPN40B Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 45
2 AZT+ DDC 14
3 AZT+ DDC+ IDV 35
4 3TC+ SQV+ AZT 29
5 D4T+ 3TC+ NFV 114
6 ABC+ EFV+ NFV 22
7 NFV+ 3TC+ D4T 18

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L10LF T12A, I13V, I15IV, E35D, M36I, R41K, R57K, I64IV, H69K, L89M  
>JPN40B| codons 1-99
PQITLWQRPFVAVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184MV       E6D, V8VI, K11T, V35T, T39K, K43E, K49KR, T69TN, K122KE, D123NS, I135T, K173I, Q174K, D177E, I178M, T200E, Q207A, R211K, K238KR, I244IV, V245E  
>JPN40B| codons 1-266
PISPIDTIPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISRIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHREKIEELRAHLLKWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPVELPEKDSWTVNDIQKLVGKLNW

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005