<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN21 JPN21A Japan 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ 3TC 17
2 IDV+ D4T+ 3TC 77
3 D4T+ 3TC+ NFV 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, M184V       E6N, V21VI, I31IT, V35T, T39K, K43E, T69TN, K122E, D123S, K173I, Q174K, D177E, I178M, Q207A, R211S, V245E S162SGIV
>JPN21A| codons 1-253
PISPINTVPVKLKPGMDGPKIKQWPLTEEKTKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQVSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, N88S L10F, T74TP, L89V K20I, M36I, L63LP, H69K, I85V, I93L  
>JPN21A| codons 1-99
PQITLWQRPFVTIKIGGQLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFIKVRQYD
QIPIEICGKKAIGPVLVGPTPVNIVGRSVLTQLGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003