<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN38 JPN38 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ DDI+ AZT 125
2 AZT+ 3TC+ NFV 4
3 AZT+ DDI 4

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F   L10I, I13V, G16E, K20I, E35D, M36I, R41K, K45V, L63LH, H69K, K70R, L89M, F99FL  
>JPN38| codons 1-99
PQITLWQRPIVTVKIEGQLIEALLDTGADDTVLEDINLPGKWKPVMIGGIGGFVKVRQYD
QIHIEICGKRAIGTVLVGPTPFNIIGRNMLTQIGCTLNL

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y       E6D, V8I, K11T, V35T, T39K, K43E, V118VI, K122E, D123S, K173I, Q174K, D177E, V179I, Q207A, R211S, K238R, V245E R78RI
>JPN38| codons 1-258
PISPIDTIPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFIELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIII
YQYMDDLYVGSDLEIGQHRTKIEELRAHLWSWGFYTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQ

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003