<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN19 JPN19A Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 14
2 AZT+ 3TC+ NFV 59

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10F G16E, K20IT, E35D, M36I, R41K, L63T, I64V, H69K, L89M, I93L  
>JPN19A| codons 1-99
PQITLWQRPFVTIKIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QITVEICGKKAIGTVLVGPTPVNIIGRSMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V       E6D, K11T, V35T, T39K, K43E, K122E, D123N, S162C, P170S, K173I, Q174K, D177E, I178M, T200A, Q207A, R211S, K238R, V245E  
>JPN19A| codons 1-251
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILESFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDS

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003