<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN31 JPN31 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ SQV 29
2 AZT+ 3TC 21
3 AZT+ 3TC+ NFV 103

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       E6ED, V35T, T39K, K43E, K122E, D123S, I135T, K173I, Q174K, D177E, I178M, Q207A, R211S, F214FL, K238R, V245T  
>JPN31| codons 1-248
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTPDKKHQKEPPFLWMGYELHPDRWT
VQPITLPE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33LI, N83D, L89IV L10LI, I13V, K20KT, A22AV, E35D, M36I, R41K, I62V, H69K  
>JPN31| codons 1-99
PQITLWQRPIVTVKIGGQLTEVLLDTGADDTVIEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLVGPTPVDIIGRNILTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003