<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN15 JPN15 Japan 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 25
2 DDC+ AZT 42
3 AZT+ DDC+ NFV 40
4 D4T+ 3TC+ IDV 73

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y K219N     E6N, K11T, V35T, T39K, K43E, V60I, V118VI, K122E, D123S, I135T, K173IV, Q174K, D177E, G196GE, Q207A, R211S, K238R, V245E  
>JPN15| codons 1-252
PISPINTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRVKNPEIVI
YQYVDDLYVGSDLEIEQHRTKIEELRAHLWSWGFYTPDNKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M L10F, L33I I13V, K20R, E35D, M36I, R41K, I64V, H69K, L89M  
>JPN15| codons 1-99
PQITLWQRPFVTVKIGGQLREALLDTGADDTVIEDINLPGKWKPKMIGGIGGFVKVRQYD
QILVEICGKKAIGTVLVGPTPVNIIGRNMMTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005