<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN30 JPN30 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 7
2 3TC+ D4T 15
3 D4T+ 3TC+ NFV 71
4 D4T+ DDI+ EFV 8
5 D4T+ 3TC+ EFV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V A62V, V75S, T215TN K103N V108VI K11T, V35T, T39K, K43E, S68G, T69S, K102R, D121H, K122E, D123S, S162N, Q174K, D177E, I178M, I180V, G196E, T200A, Q207A K220KN, K223KN
>JPN30| codons 1-230
PISPIETVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FVIKKKDGSKWRKLSDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTILDVGDAYFSVPL
HESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKKNPEMVV
YQYVDDLYVGSDLEIEQHRAKIEELRAHLLRWGFNTPDKNHQNEPPFLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10V, I13V, K20T, E35D, M36I, R41K, H69K, K70R, T74S, L89I  
>JPN30| codons 1-99
PQITLWQRPVVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKRAIGSVLVGPTPVNIIGRNIMTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005