<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN12 JPN12A Japan 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ DDI 22
2 AZT+ 3TC 61
3 D4T+ 3TC+ SQV 77

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  Q58E I13V, K20I, E35D, M36I, R41K, H69K, V82I, L89M  
>JPN12A| codons 1-99
PQITLWQRPLVTVKIGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVREYD
QILIEICGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, V75VIM, M184V, T215FV K219Q     E6D, K11T, K20R, V35T, T39K, K43E, V60I, T69N, D121H, K122E, D123S, I135IT, I167IV, K173I, Q174K, D177E, T200I, Q207A, R211S, F214FL, D218DE, L228LH, K238R, V245E K64KHNQ
>JPN12A| codons 1-252
PISPIDTVPVTLKPGMDGPRVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIQKKNSNRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
HESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKVLEPFRIKNPEIVI
YQYVDDLYVGSDLEIGQHRIKIEELRAHLLSWGLVTPEQKHQKEPPFHWMGYELHPDRWT
VQPIELPEKDSW

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003