<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN45 JPN45A Japan 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 IDV+ AZT 64
2 DDI+ D4T+ EFV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S L10F, L33LI, L89V I13V, K20T, E35D, M36I, R41K, I62IV, L63P, H69K, A71AT, T74TS  
>JPN45A| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADDTVIEDINLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGKKTIGSVLVGPTPVNIIGRSVLTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003