<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN28 JPN28 Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC 72
2 D4T+ 3TC+ NFV 80

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210LW, T215F       E6D, K11T, V35T, T39K, K43E, S68G, K122E, D123S, K173I, Q174K, D177E, I178IM, V179VI, Q207A, R211S, K238R, V245E  
>JPN28| codons 1-253
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPV
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLWSWGFFTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, N88S, L90LM L10LF I13V, K20T, E35D, M36I, R41K, H69K, K70R, A71AT, L89X  
>JPN28| codons 1-99
PQITLWQRPFVTVKIGGQLTEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKRTIGTVLVGPTPVNIIGRSXMTQIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003