<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN44 JPN44A Japan 2000 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 38
2 DDI+ D4T+ SQV+ RTV 50

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, N37D, L63P, H69K, L89M, I93L  
>JPN44A| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, T7TI, V8I, V35T, T39K, K43E, T69N, K122E, D123S, K173I, Q174K, D177E, I178M, Q207A, R211S, K238R, V245E  
>JPN44A| codons 1-253
PISPIDIIPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWT

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003