<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN44 JPN44B Japan 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ IDV 38
2 DDI+ D4T+ SQV+ RTV 103
3 DDI+ D4T+ ABC+ EFV+ LPV 26
4 DDI+ ABC+ EFV+ LPV 37

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, V8VI, V35T, T39K, K43E, T69N, K122E, D123S, K173I, Q174K, D177E, I178M, T200A, Q207A, R211S, K238R, V245E  
>JPN44B| codons 1-266
PISPIDTIPVKLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K20R, E35D, M36I, N37D, L63P, H69K, L89M, I93L  
>JPN44B| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEDIDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003