<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN43 JPN43B Japan 2002 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 DDC+ AZT 202
2 D4T+ 3TC+ NFV 67

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V, T215F D67G, K219E     E6D, K11T, V35T, T39K, M41X, V60I, S68G, K122E, D123S, I135IT, K173T, Q174K, D177E, I178M, V179VI, Q207A, R211S, V245K  
>JPN43B| codons 1-266
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEXEKEGKISKIGPENPYNTPI
FAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFFTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNW

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, L90LM L10LF I13V, I15V, K20T, E35D, M36I, R41K, H69K, A71AT, T74TS, L89X, I93IL  
>JPN43B| codons 1-99
PQITLWQRPFVTVKVGGQLTEALLDTGADDTVLEDINLPGKWKPKIIGGIGGFIKVRQYD
QILIEICGKKTIGSVLVGPTPVNIIGRNXMTQLGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005