<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN42 JPN42A Japan 1999 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ SQV 104

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82F, L90M L33F, I84L L10V, I13V, I15IV, G16E, K20I, E35D, M36I, N37ND, R41K, H69K, T74S, L89I, Q92K  
>JPN42A| codons 1-99
PQITLWQRPVVTVKVEGQLIEALLDTGADDTVFEDIDLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKKAIGSVLVGPTPFNLIGRNIMTKIGCTLNF

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003