<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
JPN42 JPN42B Japan 2001 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 D4T+ 3TC+ SQV 120
2 None 10
3 ABC+ EFV+ RTV+ APV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, V82VF, L90LM L33I, I84IL L10LV, I13V, G16E, K20KI, E35D, M36I, N37ND, R41K, H69K, T74TS, L89IM, Q92K  
>JPN42B| codons 1-99
PQITLWQRPVVTVKIEGQLIEALLDTGADDTVIEDIDLPGKWKPKMIGGIGGFVKVRQYD
QILIEICGKKAIGSVLVGPTPFNLIGRNIMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, L210W, T215Y V75M, K219Q     E6D, K11T, V35T, T39K, K43E, V60I, V118I, K122E, D123S, K173I, Q174K, D177E, I178M, V179I, Q207A, R211S, D218E, V245K  
>JPN42B| codons 1-250
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEMII
YQYVDDLYVGSDLEIGQHRTKIEELRAHLWSWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKD

References
Author Title Citation
Ariyoshi, K Patterns of point mutations associated with antiretroviral drug treatment failure in CRF01_AE (subtype E) infection differ from subtype B infection. JAIDS, 2003
Non-B Workgroup Impact of HIV-1 subtype and antiretroviral therapy on protease and reverse transcriptase genotype: Results of a global collaboration. PLoS Med, 2005