<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
18 18 Portugal 2008 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, P39PS, R41K, R57K, L63T, E65D, I72IT, L89M P81PS
>18| codons 4-99
TLWQRPVVTVKIEGQLKEALLDTGADDTVLEDINLSGKWKPKMIGGIGGFIKVKQYDQIT
IDICGHKATGTVLVGPTSVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39KR, K49KR, K122KE, D123E, S162C, K173V, Q174K, D177E, D192DN, T200A, Q207E, R211K, V245Q K43KPQT
>18| codons 38-247
CREMETEGKISRIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRVKNPEIVIYQYMDDLYVGSNLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Carvalho, A Analysis of a local HIV-1 epidemic in portugal highlights established transmission of non-B and non-G subtypes. J Clin Microbiol, 2015