<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MAK-1755 1755161 U.K. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, I31L, V35I, L100X, K103R, I135A, I178M, V179I  
>1755161| codons 18-230
GPRVKQWPLTEEKLKALIEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGFKKRKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSANN
ETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMIIYQYVDDLYVGSDLEIGQ
HRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Ait-Khaled, M Mutations in HIV-1 reverse transcriptase during therapy with abacavir, lamivudine, zidovudine in HIV-1 infected adults with no prior antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005