<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MAK-1751 1751481 U.K. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ 3TC+ ABC 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Y115F, M184V       R125K, I142V, S162A, D177E, G196E  
>1751481| codons 20-230
KVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAFFSVPLDKDFKKYTAFTIPSINNET
PGVRYQYNVLPQGWKGSPAIFQASMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHR
TKIEELRQHLLRWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Ait-Khaled, M Mutations in HIV-1 reverse transcriptase during therapy with abacavir, lamivudine, zidovudine in HIV-1 infected adults with no prior antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005