<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MAK-1858 1858161 U.K. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ AZT 16

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V T215D     K20R, D121Y, K122E, I135T, S162C, D177E, G196E, E203V, Q207E  
>1858161| codons 20-230
RVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNET
PGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEQHR
TKIVELREHLLRWGFDTPDKKHQKEPPFLWM

References
Author Title Citation
Ait-Khaled, M Mutations in HIV-1 reverse transcriptase during therapy with abacavir, lamivudine, zidovudine in HIV-1 infected adults with no prior antiretroviral therapy. Antivir Ther, 2002
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005