<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
MAK-4296 4296481 U.K. 1998 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 ABC+ AZT+ 3TC 47

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V     E138EK V90I, K173E, Q207E  
>4296481| codons 20-230
KVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEIQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSINNKT
PGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFREQNPDIVIYQYVDDLYVGSDLEIGQHR
TKIEELREHLLRWGFTTPDKKHQKEPPFLWM

References
Author Title Citation
Ait-Khaled, M Mutations in HIV-1 reverse transcriptase during therapy with abacavir, lamivudine, zidovudine in HIV-1 infected adults with no prior antiretroviral therapy. Antivir Ther, 2002
Rhee, SY Distribution of human immunodeficiency virus type 1 protease and reverse transcriptase mutation patterns in 4,183 persons undergoing genotypic resistance testing. AAC, 2004
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005