<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
HM0050F HM0050F Congo-Brazzaville 2009 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, K14R, G16A, K20I, E35D, M36I, R41K, K45R, R57K, L63P, G68E, H69K, I72V, L89M  
>HM0050F| codons 4-99
TLWQRPLVPVRIAGQLIEALLDTGADDTVLEDINLPGKWKPRMIGGIGGFIKVKQYDQIP
IEICEKKAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39LM, V60I, D121Y, K122E, I135T, K166KR, D177E, I178IM, T200A, Q207AD, R211K, P243A, I244IV, V245K  
>HM0050F| codons 38-247
CMEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQAVKLP

References
Author Title Citation
Bruzzone, B Prevalence of HIV-1 subtypes and drug resistance-associated mutations in HIV-1-positive treatment-naive pregnant women in Pointe Noire, Republic of the Congo (Kento-Mwana project). ARHR, 2015