<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt18 ALD-pt18 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I84V, L90M L10F, G73S R57K, L63P, A71V  
>ALD-pt18| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFIKVKQYD
QIPIEICGHKVISTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74LI, M184V, L210W, T215Y V75VA K103KNRS, G190GA   T39A, K43E, E44D, R83K, K102Q, V118I, K122E, S162Y, D177E, E203D, H208Y, R211K, H221HY, V245E, T286A, E297K  
>ALD-pt18| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKIADFRELNKKTQDFWEVQLGIPHPAGLKQSKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKQNPEIVI
YQYVDDLYVASDLEIGQHRTKIDELRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005