<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt17 ALD-pt17 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L210W, T215Y V75M K103N, Y181C   V21I, E28K, K32E, T39K, K43E, E44D, V60I, V111I, V118I, I142V, S162C, I178L, V179I, G196E, E203D, E204Q, H208Y, R211K, H221Y, V245T, A288S, I293V, E297K, E312EQ  
>ALD-pt17| codons 1-320
PISPIETVPVKLKPGMDGPKIKQWPLTKEKIEALVEICKELEEDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDIGDAYFSIPL
DKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDLII
CQYMDDLYVGSDLEIEQHRTKIDQLRQYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKSLTEVVPLTKEAE
LELAENREILKQPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73GS L10I, K20IM, E35D, M36I, I62IV, L63P, A71AV, I93IL  
>ALD-pt17| codons 1-99
PQITLWQRPIVTIKIGGQLMEALLDTGADDTVLEDINLPGRWKPKIIGGIGGFIKVRQYD
QVPIEICGHKVISTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012