<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt16 ALD-pt16 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, L90M F53FL, G73S L10LI, I13IV, K20R, E35D, M36I, I62IV, L63P, A71V  
>ALD-pt16| codons 1-99
PQITLWQRPIVTVKIGGQLREALLDTGADDTVLEDINLPGRWKPKMIGGIGGLVKVRQYD
QVPIEICGHKVISTVLVGPTPVNIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V35VI, A98S, K122KE, I135T, E203K, Q207E, R211RK, V245T, A272P, K277R, I293V, E297K  
>ALD-pt16| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVVPLTKEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005