<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt9 ALD-pt9 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I84V, L90M G73T L10I, I13IV, K55KR, I62IV, L63P, C67CF, K70Q, A71V, I72K, I93IL  
>ALD-pt9| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYD
QVPIEIFGHQVKTTVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F V75S, K219Q     V35I, T39A, T69E, V118I, K122E, D123DN, I135T, S162D, V179VI, I202IV, F214L, K223Q, L228H, Q278H, I293V  
>ALD-pt9| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSERWRKISDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIII
YQYVDDLYVGSDLEIGQHRTKVEELRQHLLRWGLFTPDQKHQQEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKHLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005