<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt8 ALD-pt8 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215Y V75M G190A   S3C, E6K, K43E, E44A, K122E, S162C, E169D, A272P, K277R, V317A N54NI
>ALD-pt8| codons 1-320
PICPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEAGKISKIGPEIPYNTPV
FAIKKKNSTRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPDIVI
YQYVDDLYVASDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82T L24I L10I, I15V, K20KR, E35D, M36I, G51A, I62V, L63S, I64V  
>ALD-pt8| codons 1-99
PQITLWQRPIVTIKVGGQLREALIDTGADDTVLEDINLPGRWKPKIIGGIAGFIKVRQYD
QVSVEICGHKAIGTVLVGPTPTNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012