<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt7 ALD-pt7 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, Q151QKLM, T215F K219Q Y188L   V35T, T39K, K43E, V60I, T69N, K102Q, L109LI, K122E, D123N, K166R, G196E, I202V, L210F, A272P, K277R, E297K  
>ALD-pt7| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVIDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYMDDLLVGSDLEIEQHRTKVEELRQHLFRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTKEAE
LELAENREILKEPVHGVYYD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12TA, I13IV, L19I, N37NHPT, R41K, I62IV, L63P  
>ALD-pt7| codons 1-99
PQITLWQRPLVAVKIGGQIKEALLDTGADDTVLEEMTLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Melikian, GL Standardized comparison of the relative impacts of HIV-1 reverse transcriptase (RT) mutations on nucleoside RT inhibitor susceptibility. AAC, 2012