<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ZM.HIVDRM.16 ZM.HIVDRM.16 Zambia 2010 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC|D4T|NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, M184V A62V V106A F227L T27TS, V35T, T39E, S48T, K101R, K122E, D123Q, E138A, K166R, Q174R, D177E, I178L, T200A, Q207K, R211Q, L228F, V245E, D250E, S251N, A272P, K277R, L283I, T286A, E291D, V292I, I293V  
>ZM.HIVDRM.16| codons 1-303
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICEEMEKEGKITKIGPENPYNTPV
FVIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLRKKKSATVLDVGDAYFSVPL
DEQFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKRNPELVI
YQYVDDLYVGSDLEIGQHRAKIEELRKHLLQWGFTTPDKKHQKEPPLFWMGYELHPDKWT
VQPIELPEKENWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLIRGAKALTDIVPLTEEAE
LEL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, E35D, M36I, N37S, R41N, K45R, D60E, Q61E, L63P, H69K, L89M, I93L  
>ZM.HIVDRM.16| codons 1-99
PQITLWQRPLVSIKVGGQIKEALLDTGADDTVLEDISLPGNWKPRMIGGIGGFIKVRQYE
EIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Seu, L Characterization of HIV drug resistance mutations among patients failing first-line antiretroviral therapy from a tertiary referral center in Lusaka, Zambia. J Med Virol, 2015