<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt6 ALD-pt6 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NNRTI|NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54IV, V82VA, I84V N88ND L10I, I13V, L63P, I66F, A71V, V77VI  
>ALD-pt6| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYD
QIPIEFCGHKVIGTVLIGPTPANVIGRDLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       V35T, T200A, R206RK, R211RK, K277R, T286TA, I293V, E297K  
>ALD-pt6| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELKQHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYD

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005