<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
41058 41058 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215F K219KR V106M V179D, F227L E6D, K11T, K32KE, V35T, T39K, K43E, V60I, K102KR, K103R, V118I, K122E, D123S, E138Q, S162SN, K173I, Q174K, N175NY, D177E, T200A, I202V, Q207A, R211N, K223Q  
>41058| codons 1-230
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIEALTEICKELEEEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRRKSMTVLDVGDAYFSIPL
DESFRKYTAFTIPSINNQTPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRIKYPEIDI
YQYVDDLYVGSDLEIGQHRAKVEELRAHLWNWGFFTPDRKHQQEPPLLWM

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, N37D, R41K, H69K, L89M  
>41058| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Wallis, CL Drug susceptibility and resistance mutations after first-line failure in resource limited settings. Clin Infect Dis, 2014