<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
ALD-pt1 ALD-pt1 Australia 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI|NRTI|PI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73T L10I, I15V, E35D, N37E, L63P, I64V, I66IV, A71V, V77T, I93L  
>ALD-pt1| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDMELPGRWKPKIIGGIGGFIKVRQYD
QIPVEVCGHKVITTVLTGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69S_SG, K70R, V75M, T215Y D67E G190Q   K122KE, I135T, E138A, S162CY, P170PL, H208Y, R211K, A272P, K277R, V317A P157PA
>ALD-pt1| codons 1-320
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKESSRWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNATPGIRYQYNVLPQGWKGSAAIFQYSMTKILELFRKQNPDIVI
YQYMDDLYVQSDLEIGQHRTKIEELRQYLLKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGAYYD

References
Author Title Citation
Dunne, AL Comparison of genotyping and phenotyping methods for determining susceptibility of HIV-1 to antiretroviral drugs. AIDS, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005