<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8LaBV 8LaBV56 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 56

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, V82A, L90M   L10I, I13V, K20M, M36I, L63P, I64V, H69Q  
>8LaBV56| 10 | codons 1-99 | clone 10
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV56| 14 | codons 1-99 | clone 14
PQITLWQRPVVTIKIGGQLKEALLHTGADDTVLEEMNLPGRWKPKIIGGIGGFIIVRQYD
HVPV*ICGHKAIGTVLIGPTPVNILGKNMMTKLGCTLNF
>8LaBV56| 15 | codons 1-99 | clone 15
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYE
QVPVDICGHKAIGTVLIGPTPFNIIGKNLLTQIGCTLNF
>8LaBV56| 16 | codons 1-99 | clone 16
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYE
QVPVDICGHKAIGTVLIGPTPFNIIGKNLLTQIGCTLNF
>8LaBV56| 18 | codons 1-99 | clone 18
NSPTLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV56| 22 | codons 1-99 | clone 22
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMVVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV56| 23 | codons 1-99 | clone 23
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV56| 20 | codons 1-99 | clone 20
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEKMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV56| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKIIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005