<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8LaBV 8LaBV44 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A   L10I, I13V, K20M, M36I, L63P, I64V, H69Q T26A
>8LaBV44| 19 | codons 1-99 | clone 19
PQITLWQRPVVTVKIGGQLMEALLGTGADDTVLEEINLPGRWTPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 20 | codons 1-99 | clone 20
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEKINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPASIIGRNLLTQIGCTLNF
>8LaBV44| 21 | codons 1-99 | clone 21
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 22 | codons 1-99 | clone 22
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 23 | codons 1-99 | clone 23
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 24 | codons 1-99 | clone 24
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV44| 26 | codons 1-99 | clone 26
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 28 | codons 1-99 | clone 28
PQITLWQRPVVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QVPVEICGHKAMGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 29 | codons 1-99 | clone 29
PQITLWQRPIVTVKIGGQLMEALLDAGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV44| 30 | codons 1-99 | clone 30
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV44| codons 1-99
PQITLWQRPIVTVKIGGQLMEALLDAGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005