<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CU23 CU23 Cuba 1999 HIV1 D PBMC None

Treatment History
Order Regimen Weeks
1 AZT NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, V35T, T39A, E40D, K49R, V60I, S68G, K122E, I135V, T139A, E169D, D177E, Q207E  
>CU23| codons 1-221
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALTEICADMEKEGKISRIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNEAPGIRYQYNVLPQGWKGSPAIFQSSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLLRWGFTTPDKKH

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, E35D, M36I, N37D, R41K, K43R, D60E, L63P, H69Q L5Q
>CU23| codons 1-99
PQITQWQRPLVTIKVGGQLKEALLDTGADDTVLEDIDLPGKWRPKMIGGIGGFIKVRQYE
QIPIEICGQKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Cuevas, MT High HIV-1 genetic diversity in Cuba. AIDS, 2002