<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8LaBV 8LaBV39 U.S. 1994 HIV1 B Plasma MMC

Treatment History
Order Regimen Weeks
1 NRTI+IDV 39

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A   L10I, V11A, I13V, K20M, M36I, L63P, I64V, H69Q  
>8LaBV39| 91 | codons 1-99 | clone 91
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| 92 | codons 1-99 | clone 92
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIECTLNF
>8LaBV39| 94 | codons 1-99 | clone 94
PQITLWQRPVDTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYD
QLPADICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV39| 95 | codons 1-99 | clone 95
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVRQYD
QVPVDICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| 97 | codons 1-99 | clone 97
PQITLWQRPIATVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| 98 | codons 1-99 | clone 98
PQITLWQRPIATVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| 99 | codons 1-99 | clone 99
PQITLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV39| 100 | codons 1-99 | clone 100
PQITLWQRPIATVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| 101 | codons 1-99 | clone 101
PQVTLWQRPVVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QVPVDICGHKAIGTVLIGPTPVNIIGRNLMTKLGCTLNF
>8LaBV39| 102 | codons 1-99 | clone 102
PQITLWQRPIVTVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF
>8LaBV39| codons 1-99
PQITLWQRPIATVKIGGQLMEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFIKVRQYD
QIPVEICGQKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Zhang, Y-M Drug resistance during indinavir therapy is caused by mutations in the protease gene and in its gag substrate cleavage sites. J Virol, 1997
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005